General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0MXD0",
        "id": "CENPA_MONSE",
        "source_organism": {
            "taxId": "27293",
            "scientificName": "Monosporozyma servazzii",
            "fullName": "Monosporozyma servazzii (Yeast)"
        },
        "name": "Histone H3-like centromeric protein CSE4",
        "description": [
            "Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes. Replaces conventional H3 in the nucleosome core of centromeric chromatin that serves as an assembly site for the inner kinetochore. Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division (By similarity)"
        ],
        "length": 293,
        "sequence": "MQSQQYSTPNLSLFNDGSAIIGEIRPIHGANQDVINDRALQLLQRTREHRNFLHRAHDDIRRYEPPTTQIDALENDEDENFYLNDMNTNEEYQSDRESVKSGLNSIANRYKNAVQSSPSDLDDIDFVGEEEQDLSYDESDYSDPLQEIDSNYRESPRRTTDKILKSSSKNYRRRENLGGEIRKIRQEKANKTATRYRPSDLALYEIRKYQQSTDLLISKIPFARLVKEVTDNFILENQHLQWHSMAILALQEASEAYLVGLLEHANLLALHAKRITLMKKDVQLARRIRGQFI",
        "proteome": null,
        "gene": "CSE4",
        "go_terms": [
            {
                "identifier": "GO:0046982",
                "name": "protein heterodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030527",
                "name": "structural constituent of chromatin",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000786",
                "name": "nucleosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e204a9d55ad7bafe2e507ca80f663a0ac2378352",
        "counters": {
            "domain_architectures": 87265,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 87265
        }
    }
}