General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0CZH6",
        "id": "Q0CZH6_ASPTN",
        "source_organism": {
            "taxId": "341663",
            "scientificName": "Aspergillus terreus (strain NIH 2624 / FGSC A1156)",
            "fullName": "Aspergillus terreus (strain NIH 2624 / FGSC A1156)"
        },
        "name": "Large ribosomal subunit protein uL30m",
        "description": [
            "Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane"
        ],
        "length": 94,
        "sequence": "MSYFRITLLRSAIGLPRRTTDVLKALGLKKRMATVFHPVSPSVAGQIMRVKELVDVQEVDRRLTKQEVHLERKPDPGYYIEQKSGTEWKEKRGY",
        "proteome": null,
        "gene": "ATEG_00908",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015934",
                "name": "large ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2c8484a15f6278a8dcdec4735d6c22a76d94f122",
        "counters": {
            "domain_architectures": 26014,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26014
        }
    }
}