GET /api/protein/UniProt/Q0AW51/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q0AW51",
"id": "Q0AW51_SYNWW",
"source_organism": {
"taxId": "335541",
"scientificName": "Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)",
"fullName": "Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)"
},
"name": "CRISPR system Cms protein Csm2",
"description": [
"This subunit may be involved in monitoring complementarity of crRNA and target RNA"
],
"length": 158,
"sequence": "MSNMREAFRKAGYKDTQAQTEKPSQSQPAVGQFQLGINYTAQAEQVIQELKKSMGRNYQNFTTSKIRNILAQVSEIYNDVRAENDVFLSPDLQNRIEYLKVRLVYECGREPWIIKPFVDKAKLLDLLNNIGDNRQNFIKFARYMEALVAYHRFYGGRD",
"proteome": "UP000001968",
"gene": "Swol_1755",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "77821ea4cd9336c18382c7616cae78cd5a318546",
"counters": {
"domain_architectures": 858,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 858
}
}
}