General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0AW51",
        "id": "Q0AW51_SYNWW",
        "source_organism": {
            "taxId": "335541",
            "scientificName": "Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)",
            "fullName": "Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)"
        },
        "name": "CRISPR system Cms protein Csm2",
        "description": [
            "This subunit may be involved in monitoring complementarity of crRNA and target RNA"
        ],
        "length": 158,
        "sequence": "MSNMREAFRKAGYKDTQAQTEKPSQSQPAVGQFQLGINYTAQAEQVIQELKKSMGRNYQNFTTSKIRNILAQVSEIYNDVRAENDVFLSPDLQNRIEYLKVRLVYECGREPWIIKPFVDKAKLLDLLNNIGDNRQNFIKFARYMEALVAYHRFYGGRD",
        "proteome": "UP000001968",
        "gene": "Swol_1755",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "77821ea4cd9336c18382c7616cae78cd5a318546",
        "counters": {
            "domain_architectures": 858,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 858
        }
    }
}