HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q09YK7",
"id": "WNT2_ATEGE",
"source_organism": {
"taxId": "9509",
"scientificName": "Ateles geoffroyi",
"fullName": "Ateles geoffroyi (Black-handed spider monkey)"
},
"name": "Protein Wnt-2",
"description": [
"Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity)"
],
"length": 360,
"sequence": "MNSPLRGIWLWLPLLLTWLTPEVSSSWWYMGATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAIGLGVTEWTAECQYQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSGKDSKGVFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKSVKRFLKQECKCHGVSGSCSLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDRETGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMIKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTPT",
"proteome": null,
"gene": "WNT2",
"go_terms": [
{
"identifier": "GO:0005102",
"name": "signaling receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007275",
"name": "multicellular organism development",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016055",
"name": "Wnt signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3d8ab4a8c72a934a2cb4d67bef6e4e729ce824f1",
"counters": {
"domain_architectures": 52290,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"smart": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"prints": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 52290
}
}
}