GET /api/protein/UniProt/Q09YK7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q09YK7",
        "id": "WNT2_ATEGE",
        "source_organism": {
            "taxId": "9509",
            "scientificName": "Ateles geoffroyi",
            "fullName": "Ateles geoffroyi (Black-handed spider monkey)"
        },
        "name": "Protein Wnt-2",
        "description": [
            "Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity)"
        ],
        "length": 360,
        "sequence": "MNSPLRGIWLWLPLLLTWLTPEVSSSWWYMGATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAIGLGVTEWTAECQYQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSGKDSKGVFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKSVKRFLKQECKCHGVSGSCSLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDRETGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMIKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTPT",
        "proteome": null,
        "gene": "WNT2",
        "go_terms": [
            {
                "identifier": "GO:0005102",
                "name": "signaling receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007275",
                "name": "multicellular organism development",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016055",
                "name": "Wnt signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3d8ab4a8c72a934a2cb4d67bef6e4e729ce824f1",
        "counters": {
            "domain_architectures": 52290,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "smart": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 52290
        }
    }
}