HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q09TW8",
"id": "Q09TW8_9LECA",
"source_organism": {
"taxId": "50939",
"scientificName": "Stereocaulon tomentosum",
"fullName": "Stereocaulon tomentosum"
},
"name": "Tubulin beta chain",
"description": [
"Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin"
],
"length": 237,
"sequence": "ASGNKYVPRAVLVDLEPGTMDAVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDQVLDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFPDRMMATFSVVPSPKVSDTVVEPYNATLSVHQLVENSDETFCIDNEALYDICMRTLKLSNPSYGDLNHLVSAVMSGITTCLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSRGAHSFRAVTVPELT",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007017",
"name": "microtubule-based process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005874",
"name": "microtubule",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005200",
"name": "structural constituent of cytoskeleton",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "035d8c2f254fa7c1233bc59bbfbeb236be6c1f49",
"counters": {
"domain_architectures": 35262,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 2,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 35262
}
}
}