GET /api/protein/UniProt/Q08AZ0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q08AZ0",
        "id": "Q08AZ0_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Protein phosphatase 1L",
        "description": [
            "Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6"
        ],
        "length": 360,
        "sequence": "MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVQMVKGKVVEMMHNERLGGIDVLEAEFSKTWEYKSNNVAVYSIQGRRDHMEDRFEIITDLLNKSHPSIFGIFDGHGGESAAEYVKIHLPEVLKQHLQDFERDKENNVLSYQTILEQQILAIDRELLEKLSVSYDEAGTTCLIALLSDKELTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVIISDPDILSFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFKNSSKTDEQ",
        "proteome": "UP000186698",
        "gene": "ppm1l.S",
        "go_terms": [
            {
                "identifier": "GO:0004722",
                "name": "protein serine/threonine phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006470",
                "name": "protein dephosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043169",
                "name": "cation binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9761dfa8fcbc09f23441e5fd2f8dffed523952dd",
        "counters": {
            "domain_architectures": 75992,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 75992
        }
    }
}