HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q08AZ0",
"id": "Q08AZ0_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Protein phosphatase 1L",
"description": [
"Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6"
],
"length": 360,
"sequence": "MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVQMVKGKVVEMMHNERLGGIDVLEAEFSKTWEYKSNNVAVYSIQGRRDHMEDRFEIITDLLNKSHPSIFGIFDGHGGESAAEYVKIHLPEVLKQHLQDFERDKENNVLSYQTILEQQILAIDRELLEKLSVSYDEAGTTCLIALLSDKELTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVIISDPDILSFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFKNSSKTDEQ",
"proteome": "UP000186698",
"gene": "ppm1l.S",
"go_terms": [
{
"identifier": "GO:0004722",
"name": "protein serine/threonine phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006470",
"name": "protein dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043169",
"name": "cation binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9761dfa8fcbc09f23441e5fd2f8dffed523952dd",
"counters": {
"domain_architectures": 75992,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 2,
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 75992
}
}
}