HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q087W5",
"id": "PYRC_SHEFN",
"source_organism": {
"taxId": "318167",
"scientificName": "Shewanella frigidimarina (strain NCIMB 400)",
"fullName": "Shewanella frigidimarina (strain NCIMB 400)"
},
"name": "Dihydroorotase",
"description": [
"Catalyzes the reversible cyclization of carbamoyl aspartate to dihydroorotate"
],
"length": 345,
"sequence": "MTQITLTTPDDWHLHFRDGDMLGETVPATARLFQRAIVMPNLVPPVTTAAMALAYRDRILAARPQGSNFEPLMTLFLTNNTSAQDIIDAKAAGVVAGKLYPAGATTNSDAAVKALDELFPIFEVMAQQGMLLLVHGEVTESHIDIFDREKMFIDRYLSRIVEAIPSLKVVFEHITTKEAAEFVAEASANVAATITPQHLLLNRNDLLVGGVRPHNFCLPVLKRNIHQHALQAAVATGSSKFFLGTDSAPHEKHRKESACGCAGCYSAWSALELYAQVFDNLGALDKLEGFASLHGADFYGLPRNSGTVTLVKQEWTVPEEIILPNGNPIVPFFAGQKVNWKVKTA",
"proteome": "UP000000684",
"gene": "pyrC",
"go_terms": [
{
"identifier": "GO:0004151",
"name": "dihydroorotase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019856",
"name": "pyrimidine nucleobase biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016812",
"name": "hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "51d6f0d2568382f7084989f0f7cdc72064d17026",
"counters": {
"domain_architectures": 188509,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 188509
}
}
}