GET /api/protein/UniProt/Q072A9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q072A9",
        "id": "Q072A9_BRUML",
        "source_organism": {
            "taxId": "274058",
            "scientificName": "Brucella melitensis biovar Melitensis",
            "fullName": "Brucella melitensis biovar Melitensis"
        },
        "name": "Large ribosomal subunit protein uL4",
        "description": [
            "Forms part of the polypeptide exit tunnel",
            "One of the primary rRNA binding proteins, this protein initially binds near the 5'-end of the 23S rRNA. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome"
        ],
        "length": 206,
        "sequence": "MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTGSKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKASDLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGINVYDILRRGKLVLSKAAVEALEERFK",
        "proteome": null,
        "gene": "rplD",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "55256980899bda0cbbb0a12f4738c69d0597de72",
        "counters": {
            "domain_architectures": 31545,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 31545
        }
    }
}