GET /api/protein/UniProt/Q02KT3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q02KT3",
        "id": "LPXH_PSEAB",
        "source_organism": {
            "taxId": "208963",
            "scientificName": "Pseudomonas aeruginosa (strain UCBPP-PA14)",
            "fullName": "Pseudomonas aeruginosa (strain UCBPP-PA14)"
        },
        "name": "UDP-2,3-diacylglucosamine hydrolase",
        "description": [
            "Hydrolyzes the pyrophosphate bond of UDP-2,3-diacylglucosamine to yield 2,3-diacylglucosamine 1-phosphate (lipid X) and UMP by catalyzing the attack of water at the alpha-P atom. Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
        ],
        "length": 240,
        "sequence": "MSVLFISDLHLEAERPDITRAFLSFLDERARRAEALYILGDFFEAWIGDDGMDAFQRSIAQSLRQVADGGTRIYLMHGNRDFLIGKAFCREAGCTLLPDPSVIDLYGEPVLLMHGDSLCTRDEAYMRLRRWLRNPLTLWVLRHLPLATRHKLARKLRKESRAQTRMKAVDIIDVTPEEVPRVMRGHGVRTLIHGHTHRPAEHPLDIDGQPARRIVLGDWDRQGWALEIDANGHRQAPFPL",
        "proteome": null,
        "gene": "lpxH",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016462",
                "name": "pyrophosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009245",
                "name": "lipid A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e949b0a1fe9e51299d6615c55240932f5c7152f8",
        "counters": {
            "domain_architectures": 234891,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 234891
        }
    }
}