General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q01656",
        "id": "RSP4_CHLRE",
        "source_organism": {
            "taxId": "3055",
            "scientificName": "Chlamydomonas reinhardtii",
            "fullName": "Chlamydomonas reinhardtii"
        },
        "name": "Flagellar radial spoke protein 4",
        "description": [
            "Flagellar radial spokes contribute to the regulation of dynein arm activity and thus the pattern of flagellar bending. They consist of a thin stalk, which is attached to the a subfiber of the outer doublet microtubule, and a bulbous head, which is attached to the stalk and appears to interact with the projections from the central pair of microtubules"
        ],
        "length": 465,
        "sequence": "MAAVDSVAQALAYLQVHSPQDGTSMYDHLVKLVSKVLEDQPKNAVDLLETSLLVKKSTFDPKESSPLVPIPVAPDATQTQAAVSIFGDPELPINPATGEPVPADPPNEFEAENMLGAAAVLDCLGVGLGRELGVNIALAAKRIGEDPKLAVRSVRFFGKFLGLYSDYFVFEVAFKKEAAKEAAPAAPAPERVEGEAASSSAPEVPVEEPGKGANKFTYLVCSSLGGPLTRLPDVTPAQVKASRRIKKLLTGRLTSHVSTYPAFPGNEANYLRALIARISAATVVAPSDLFSLNDETGELERAEDWEPPAGREMAAPTAWVHVRPHLKSQGRCEVHKRELPEDADEDEFYNEDELEEGPDLLAALEEDAQLPGEQAAWTPIYSSASEAVKTQAGGLRSLVWPGAVCGGRGSEWTCVYVGWGVKNAPFVPLPPPPVAQEFAWGEVETQELELKPAPPPPEEEAEADE",
        "proteome": null,
        "gene": "RSP4",
        "go_terms": [
            {
                "identifier": "GO:0060271",
                "name": "cilium assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0060294",
                "name": "cilium movement involved in cell motility",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0001534",
                "name": "radial spoke",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "05fcbf9f480ee1eefa0523e3c9774db163c5bbd9",
        "counters": {
            "domain_architectures": 2908,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 3,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2908
        }
    }
}