General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P9WLL9",
        "id": "Y2067_MYCTU",
        "source_organism": {
            "taxId": "83332",
            "scientificName": "Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)",
            "fullName": "Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)"
        },
        "name": "S-adenosyl-L-methionine-dependent methyltransferase Rv2067c",
        "description": [
            "Involved in epigenetic reprogramming of the human host cells for the benefit of intracellular survival of the pathogen. Trimethylates 'Lys-79' of human histone H3 forming the so called H3K79me3 mark in the THP-1 macrophages upon M.tuberculosis infection. Acts specifically on free non-nucleosomal histone H3. Alters gene expression of the macrophage post-infection by adding the H3K79me3 mark on genes involved in defense response to increase pathogenesis. Represses methyltransferase DOT1L resulting in reduction of DOT1L-specific nucleosomal H3K79me3 mark and thus in reduced expression of pro-inflammatory cytokines IL6 and TNF leading ultimately to inhibition of caspase-8-dependent apoptosis and enhancement of RIPK3-mediated programmed necrosis. Up-regulates the expression of TMTC1, SESN3 and NLRC3 enabling the pathogen to overcome host inflammatory and oxidative responses"
        ],
        "length": 407,
        "sequence": "MTDDHPRADIVSRQYHRWLYPHPIADLEAWTTANWEWFDPVHSHRILWPDREYRPDLDILIAGCGTNQAAIFAFTNRAAKVVAIDISRPALDHQQYLKDKHGLANLELHLLPIEELATLGRDFDLVVSTGVLHHLADPRAGMKELAHCLRRDGVVAAMLYGKYGRIGVELLGSVFRDLGLGQDDASIKLAKEAISLLPTYHPLRNYLTKARDLLSDSALVDTFLHGRQRSYTVEECVDLVTSAGLVFQGWFHKAPYYPHDFFVPNSEFYAAVNTLPEVKAWSVMERLETLNATHLFMACRRDRPKEQYTIDFSTVAALDYVPLMRTRCGVSGTDMFWPGWRMAPSPAQLAFLQQVDGRRTIREIAGCVARTGEPSGGSLADLEEFGRKLFQSLWRLDFVAVALPASG",
        "proteome": "UP000001584",
        "gene": "Rv2067c",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c043aa35505ceaded7954fe53dbc11785f5f9abb",
        "counters": {
            "domain_architectures": 25086,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25086
        }
    }
}