GET /api/protein/UniProt/P9WIL4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P9WIL4",
"id": "PANC_MYCTO",
"source_organism": {
"taxId": "83331",
"scientificName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)",
"fullName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)"
},
"name": "Pantothenate synthetase",
"description": [
"Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate"
],
"length": 309,
"sequence": "MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN",
"proteome": "UP000001020",
"gene": "panC",
"go_terms": [
{
"identifier": "GO:0004592",
"name": "pantoate-beta-alanine ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015940",
"name": "pantothenate biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b3342d96d025f0969eac1a876f6342ef41f43620",
"counters": {
"domain_architectures": 23929,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 10,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 23929
}
}
}