General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P9WHK2",
        "id": "PYRR_MYCTO",
        "source_organism": {
            "taxId": "83331",
            "scientificName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)",
            "fullName": "Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)"
        },
        "name": "Bifunctional protein PyrR",
        "description": [
            "Regulates the transcription of the pyrimidine nucleotide (pyr) operon in response to exogenous pyrimidines",
            "Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant"
        ],
        "length": 193,
        "sequence": "MGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDDLMIKPPRPLASTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR",
        "proteome": "UP000001020",
        "gene": "pyrR",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
        "counters": {
            "domain_architectures": 136430,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 136430
        }
    }
}