General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P84012",
        "id": "TX34A_PHOKE",
        "source_organism": {
            "taxId": "272754",
            "scientificName": "Phoneutria keyserlingi",
            "fullName": "Phoneutria keyserlingi (Brazilian wandering spider)"
        },
        "name": "U7-ctenitoxin-Pk1a",
        "description": [
            "Blocks voltage-gated sodium channels (Nav). Causes immediate spastic paralysis and death in mice within 1 minute of injection at dose levels of 1.5 ug per mouse"
        ],
        "length": 54,
        "sequence": "ATCAGQDKPCKETCDCCGERGECVCGLSYEGKYRCICRQGTFLIAWYKLASCKK",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8d9e001fd4a83dad7d18e474559a70b51b0b79fb",
        "counters": {
            "domain_architectures": 15,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15
        }
    }
}