General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P83620",
        "id": "TXC1B_CUPSA",
        "source_organism": {
            "taxId": "6928",
            "scientificName": "Cupiennius salei",
            "fullName": "Cupiennius salei (American wandering spider)"
        },
        "name": "Cupiennin-1b",
        "description": [
            "Has antimicrobial activity against E.coli, E.faecalis, P.aeruginosa, and S.aureus. Has insecticidal and hemolytic activities. Probably acts by disturbing membrane function with its amphipathic structure"
        ],
        "length": 35,
        "sequence": "GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0042742",
                "name": "defense response to bacterium",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "78fba9e072841a35fec2d1cc9d8620c982182a70",
        "counters": {
            "domain_architectures": 20,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 20
        }
    }
}