General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P69165",
        "id": "CALC2_ONCGO",
        "source_organism": {
            "taxId": "8017",
            "scientificName": "Oncorhynchus gorbuscha",
            "fullName": "Oncorhynchus gorbuscha (Pink salmon)"
        },
        "name": "Calcitonin-2",
        "description": [
            "Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones"
        ],
        "length": 32,
        "sequence": "CSNLSTCVLGKLSQDLHKLQTFPRTNTGAGVP",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5d547907d6b832628699bd68149ea78b42a3fa12",
        "counters": {
            "domain_architectures": 4087,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4087
        }
    }
}