General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P67974",
        "id": "INS_PHYMC",
        "source_organism": {
            "taxId": "9755",
            "scientificName": "Physeter macrocephalus",
            "fullName": "Physeter macrocephalus (Sperm whale)"
        },
        "name": "Insulin",
        "description": [
            "Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver"
        ],
        "length": 51,
        "sequence": "FVNQHLCGSHLVEALYLVCGERGFFYTPKAGIVEQCCTSICSLYQLENYCN",
        "proteome": "UP000248484",
        "gene": "INS",
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b9ca085d0992375b116a007d7162409be3587261",
        "counters": {
            "domain_architectures": 6728,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6728
        }
    }
}