General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P65322",
        "id": "LPXD_ECOL6",
        "source_organism": {
            "taxId": "199310",
            "scientificName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)",
            "fullName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)"
        },
        "name": "UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase",
        "description": [
            "Catalyzes the N-acylation of UDP-3-O-(hydroxytetradecanoyl)glucosamine using 3-hydroxytetradecanoyl-ACP as the acyl donor. Is involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
        ],
        "length": 341,
        "sequence": "MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD",
        "proteome": "UP000001410",
        "gene": "lpxD",
        "go_terms": [
            {
                "identifier": "GO:0016747",
                "name": "acyltransferase activity, transferring groups other than amino-acyl groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009245",
                "name": "lipid A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016410",
                "name": "N-acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4ef58594b4e846d0d1e4e793a40ab50c1688fc65",
        "counters": {
            "domain_architectures": 2865,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2865
        }
    }
}