General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P62184",
        "id": "CALM_RENRE",
        "source_organism": {
            "taxId": "6136",
            "scientificName": "Renilla reniformis",
            "fullName": "Renilla reniformis (Sea pansy)"
        },
        "name": "Calmodulin",
        "description": [
            "Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases"
        ],
        "length": 149,
        "sequence": "MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVKMMTSK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4403894abd2a553d27123253401701775ffd4bde",
        "counters": {
            "domain_architectures": 58144,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 58144
        }
    }
}