GET /api/protein/UniProt/P61926/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P61926",
"id": "IPKA_RABIT",
"source_organism": {
"taxId": "9986",
"scientificName": "Oryctolagus cuniculus",
"fullName": "Oryctolagus cuniculus (Rabbit)"
},
"name": "cAMP-dependent protein kinase inhibitor alpha",
"description": [
"Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains"
],
"length": 76,
"sequence": "MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES",
"proteome": "UP000001811",
"gene": "PKIA",
"go_terms": [
{
"identifier": "GO:0004862",
"name": "cAMP-dependent protein kinase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006469",
"name": "negative regulation of protein kinase activity",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "32eeb43e0e7af0c3d1ab36803098211898add135",
"counters": {
"domain_architectures": 3412,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 21,
"taxa": 1,
"dbEntries": {
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3412
}
}
}