HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P59124",
"id": "RS5_SHEON",
"source_organism": {
"taxId": "211586",
"scientificName": "Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)",
"fullName": "Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)"
},
"name": "Small ribosomal subunit protein uS5",
"description": [
"With S4 and S12 plays an important role in translational accuracy",
"Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body"
],
"length": 167,
"sequence": "MAKLEAQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGYGYGKAREVPAAIQKAMEKARRNMVTVELNAGTLHHPVKGRHTGSRVYMQPASQGTGIIAGGAMRAVLEVAGVHNVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG",
"proteome": "UP000008186",
"gene": "rpsE",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015935",
"name": "small ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ddb47877d1b64f864fa25e376c154e201459d42b",
"counters": {
"domain_architectures": 34638,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 1,
"pfam": 2,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 34638
}
}
}