GET /api/protein/UniProt/P58290/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P58290",
        "id": "SIGA_LACLC",
        "source_organism": {
            "taxId": "1359",
            "scientificName": "Lactococcus lactis subsp. cremoris",
            "fullName": "Lactococcus lactis subsp. cremoris"
        },
        "name": "RNA polymerase sigma factor SigA",
        "description": [
            "Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is the primary sigma factor during exponential growth"
        ],
        "length": 364,
        "sequence": "AYEKAVKGYITKRKPLGEALDEEIMDELSVKFGIVDDALEDLFKQIQDAGISIVDKDGNPSPLALVTDEIEKEEVSDTAMDEIVTNVRIDDPVRMYLKEIGRYPLISLDEETKLAEAIIAGGEGAEFAKQMLAEANLRLVVSIAKRYSGRGMQFLDLIQEGNMGLMKAVDKFDQTKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRNLLQELGRDPSPEEIGKELHMAPDKVREVLKIAQEPVSLETPIGEEDDSHLGDFIEDDVIESPVDYTNRILLREQLDEVMDTLTDREENVLRMRFGLDDGRMHTLEDVGKQFKVTRERIRQIEAKAIKKLRHPRRSKPLRDFM",
        "proteome": null,
        "gene": "sigA",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016987",
                "name": "sigma factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "41a8f181f68a2cf6ac76326aa492c0982e891e60",
        "counters": {
            "domain_architectures": 23183,
            "entries": 30,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 3,
                "pfam": 4,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 3,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 12
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 23183
        }
    }
}