HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P53409",
"id": "ISL3_ONCTS",
"source_organism": {
"taxId": "74940",
"scientificName": "Oncorhynchus tshawytscha",
"fullName": "Oncorhynchus tshawytscha (Chinook salmon)"
},
"name": "Insulin gene enhancer protein ISL-3",
"description": [
"Binds to one of the cis-acting domain of the insulin gene enhancer. May be involved in subtype specialization of primary motoneurons"
],
"length": 363,
"sequence": "MVDIIFNSSFLGDMGDHSKKKSGFAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQYLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCNLGFSSSDLVMRARDNVYHIECFRCSVCSRQLLPGDEFSLRDEELLCRADHSLLMERTSAGSPISPGHIHSNRSLHLAAEPVTVRAPHRNHVHKQSEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMREQLVEMTGLSPRVIRVWFQNKRCKDKKRSILMKQLQQQQHSDKTVSIFSLQGLTGTPLVARSPIRHDNTVQGNSVEVQTYQPPWKALSEFALQSDLDQPAFQQLVPFSESGSLGNSSGSDVTSLSSHLPDTPNSMVPSPVET",
"proteome": "UP000694402",
"gene": "isl3",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000981",
"name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045944",
"name": "positive regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0048665",
"name": "neuron fate specification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9df4db78da89de75c996e6971cfd5463e5e014f5",
"counters": {
"domain_architectures": 13971,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"profile": 2,
"smart": 2,
"cdd": 3,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 13971
}
}
}