HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P50562",
"id": "RL18_HALSA",
"source_organism": {
"taxId": "64091",
"scientificName": "Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)",
"fullName": "Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)"
},
"name": "Large ribosomal subunit protein uL18",
"description": [
"This is one of the proteins that bind and probably mediate the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance"
],
"length": 183,
"sequence": "MATGPRYKVPMRRRREVRTDYHQRLRLLKSGKPRLVARKSNKHVTAQLVTTGPDGDETVASAHSSDLDAYGWAAPTGNLPAAYLTGLLAGQRAVDAGVEEAVLDIGLNTATPGSKVFAIQEGAIDAGLDVPHNDSVLADWSRTRGEHIAEYAESLDEPLYSGDFDATALPAHFDETREAIMED",
"proteome": "UP000000554",
"gene": "rpl18",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008097",
"name": "5S rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ded892f21fa78bfe696caed0b933999f53837379",
"counters": {
"domain_architectures": 746,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 746
}
}
}