GET /api/protein/UniProt/P42953/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P42953",
"id": "TAGG_BACSU",
"source_organism": {
"taxId": "224308",
"scientificName": "Bacillus subtilis (strain 168)",
"fullName": "Bacillus subtilis (strain 168)"
},
"name": "Teichoic acid translocation permease protein TagG",
"description": [
"Part of the ABC transporter complex TagGH (TC 3.A.1.34.1) involved in exporting the two types of intracellularly synthesized teichoic acids. Probably responsible for the translocation of the substrate across the membrane"
],
"length": 275,
"sequence": "MNDLLRILREQITSFPLILRLAAYETKSKYQMNYLGVLWQFLNPLIQMLAYWFVFGMGIRKGGPVTTGAGEVPFIIWMLAGLIPWFFISPTILDGSNSVFKRINMVAKMNFPISSLPSVAIASNLFSYMIMMVIYIIVLLVNGVFPSVHWLQYIYYFICMIAFMFSFSLFNSTISVLIRDYQFLLQAVTRLLFFLLPIFWDVNAKLGQSHPELVPVLKLNPLFYIIEGFRNSFLDGAWFFHDMKYTLYFWLFTFLLLLVGSILHMKFRDKFVDFL",
"proteome": "UP000001570",
"gene": "tagG",
"go_terms": [
{
"identifier": "GO:0140359",
"name": "ABC-type transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8f38eedd1c56d1feb9352ec1d060393d0e636d24",
"counters": {
"domain_architectures": 95534,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"profile": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 95534
}
}
}