General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P40043",
        "id": "RGI1_YEAST",
        "source_organism": {
            "taxId": "559292",
            "scientificName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)",
            "fullName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)"
        },
        "name": "Respiratory growth induced protein 1",
        "description": [
            "Involved in the control of energetic metabolism and significantly contribute to cell fitness, especially under respiratory growth conditions"
        ],
        "length": 161,
        "sequence": "MTKKDKKEVKVQTVTTEDGETVKVFEDLQGFETFIANETEDDDFDHLHCKLNYYPPFVLHESHEDPEKISDAANSHSKKFVRHLHQHIEKHLLKDIKQAVRKPELKFHEKSKEETFDKITWHYGEETEYHGRPFKIDVQVVCTHEDAMVFVDYKTHPVGAN",
        "proteome": "UP000002311",
        "gene": "RGI1",
        "go_terms": [
            {
                "identifier": "GO:0006112",
                "name": "energy reserve metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "57f7fa88b6fb6d313e38d7b97d0dc4cd410fc401",
        "counters": {
            "domain_architectures": 200,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 200
        }
    }
}