GET /api/protein/UniProt/P36816/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P36816",
"id": "VE7_HPV07",
"source_organism": {
"taxId": "10620",
"scientificName": "Human papillomavirus 7",
"fullName": "Human papillomavirus 7"
},
"name": "Protein E7",
"description": [
"Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Also plays a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta)"
],
"length": 111,
"sequence": "MHGERPTLGDIVLDLQPEPVSLSCNEQLDSSDSEDDHEQDQLDSSHNRQREQPTQQDLQVNLQSFKIVTHCVFCHCLVRLVVHCTATDIRQVHQLLMGTLNIVCPNCAATA",
"proteome": "UP000008226",
"gene": "E7",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "775889284a0d0bec2201f51c28688b33e858eeb5",
"counters": {
"domain_architectures": 2302,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2302
}
}
}