GET /api/protein/UniProt/P36802/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P36802",
"id": "VE6_HPV10",
"source_organism": {
"taxId": "333759",
"scientificName": "Human papillomavirus type 10",
"fullName": "Human papillomavirus type 10"
},
"name": "Protein E6",
"description": [
"Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Sequesters tumor suppressor TP53 in the host cytoplasm and modulates its activity by interacting with host EP300 that results in the reduction of TP53 acetylation and activation. In turn, apoptosis induced by DNA damage is inhibited. E6 also protects host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response"
],
"length": 148,
"sequence": "MSMGAQEPRNILLLCRNCGIPLEDLRLCCIFCTKQLTAAELAAFALRELYLVWRAGVPYGACARCLLLQGIVRRLKYWDYSYYVEGVEEETKQSIYTQLIRCYMCHKPLVREEKDRHRNERRRLHKISGYWRGSCEYCWSRCTVRIPQ",
"proteome": "UP000009105",
"gene": "E6",
"go_terms": null,
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "730136671aace6ff6b5909f8760c6baaab2b52a2",
"counters": {
"domain_architectures": 3542,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3542
}
}
}