GET /api/protein/UniProt/P33960/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P33960",
        "id": "GVPG2_HALSA",
        "source_organism": {
            "taxId": "64091",
            "scientificName": "Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)",
            "fullName": "Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)"
        },
        "name": "Gas vesicle protein G2",
        "description": [
            "Proteins GvpF to GvpM might be involved in nucleating gas vesicle formation. A minor component of the gas vesicle (By similarity). Gas vesicles are hollow, gas filled proteinaceous nanostructures found in several microbial planktonic microorganisms. They allow positioning of halobacteria at the optimal depth for growth in the poorly aerated, shallow brine pools of their habitat (PubMed:33711860)",
            "Expression of 2 c-vac DNA fragments containing 2 divergently transcribed regions (gvpE-gvpF-gvpG-gvpH-gvpI-gvpJ-gvpK-gvpL-gvpM and gvpA-gvpC-gvpN-gvpO) allows H.volcanii to produce gas vesicles"
        ],
        "length": 83,
        "sequence": "MFVLDDLFVNPFLSLVDILQTMALDELYDTSEIRDQIKENQLLYEIGDRPADEYERRKQELEAQLRTAEQIRDQMRDRMEIKN",
        "proteome": "UP000000554",
        "gene": "gvpG2",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ff230125089fe982e66e742fd446ccd14f90dc12",
        "counters": {
            "domain_architectures": 2396,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2396
        }
    }
}