General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P27262",
        "id": "TRAP_TYLCI",
        "source_organism": {
            "taxId": "66366",
            "scientificName": "Tomato yellow leaf curl virus (strain Israel)",
            "fullName": "Tomato yellow leaf curl virus (strain Israel) (TYLCV)"
        },
        "name": "Transcriptional activator protein",
        "description": [
            "Multifunctional protein that modulates host antiviral defenses and promotes host attractiveness to insect vectors. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. TrAP suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense",
            "Inhibits signal transduction by the phytohormone jasmonate, making the infected plant more attractive to aphids, which are the second host to play a role as a dissemination vector (PubMed:30789967). Acts by binding to ubiquitin precursor RPS27A, thereby preventing ubiquitin degradation of JAZ (PubMed:30789967)"
        ],
        "length": 135,
        "sequence": "MQPSSPSTSHCSQVSIKVQHKIAKKKPIRRKRVDLDCGCSYYLHLNCNNHGFTHRGTHHCSSGREWRFYLGDKQSPLFQDNRTQPEAISNEPRHHFHSDKIQPQHQEGNGDSQMFSRLPNLDDITASDWSFLKSI",
        "proteome": "UP000007547",
        "gene": "C2",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "21ebf865137f01d276c484209b4972ea17d60f2f",
        "counters": {
            "domain_architectures": 4559,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "prints": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4559
        }
    }
}