General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P22231",
        "id": "CAP8_ADECG",
        "source_organism": {
            "taxId": "10513",
            "scientificName": "Canine adenovirus serotype 1 (strain Glaxo)",
            "fullName": "Canine adenovirus serotype 1 (strain Glaxo) (CAdV-1)"
        },
        "name": "Pre-hexon-linking protein VIII",
        "description": [
            "Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together"
        ],
        "length": 71,
        "sequence": "GSRSSFSPTQAFLTLQQASSTPRTGGVGSYQFVREFVPEVYLNPFSGPPDTFPDQFIPNYDIVTNSVDGYD",
        "proteome": null,
        "gene": "L4",
        "go_terms": [
            {
                "identifier": "GO:0031423",
                "name": "hexon binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "f20532aa3c92fe0868b9131ac7c10faaf42c982c",
        "counters": {
            "domain_architectures": 376,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 376
        }
    }
}