General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P21841",
        "id": "PSPC_MOUSE",
        "source_organism": {
            "taxId": "10090",
            "scientificName": "Mus musculus",
            "fullName": "Mus musculus (Mouse)"
        },
        "name": "Surfactant protein C",
        "description": [
            "Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces"
        ],
        "length": 193,
        "sequence": "MDMSSKEVLMESPPDYSAGPRSQFRIPCCPVHLKRLLIVVVVVVLVVVVIVGALLMGLHMSQKHTEMVLEMSIGAPETQKRLAPSERADTIATFSIGSTGIVVYDYQRLLTAYKPAPGTYCYIMKMAPESIPSLEAFARKLQNFRAKPSTPTSKLGQEEGHDTGSESDSSGRDLAFLGLAVSTLCGELPLYYI",
        "proteome": "UP000000589",
        "gene": "Sftpc",
        "go_terms": [
            {
                "identifier": "GO:0007585",
                "name": "respiratory gaseous exchange by respiratory system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4d07ad09b1d0142518d1dddb97b95283cbc5d64e",
        "counters": {
            "domain_architectures": 724,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "smart": 2,
                "cathgene3d": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 724
        }
    }
}