General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P19416",
        "id": "SF33K_ADE41",
        "source_organism": {
            "taxId": "10524",
            "scientificName": "Human adenovirus F serotype 41",
            "fullName": "Human adenovirus F serotype 41 (HAdV-41)"
        },
        "name": "Protein 33K",
        "description": [
            "Promotes alternative splicing of late transcripts by promoting splicing at weak 3' splice sites. Required for the temporal activation of major late pre-mRNA splicing at late times of infection. Induces the splicing and expression of the late capsid vertex protein (By similarity)",
            "Probably functions as the small terminase that is part of the molecular motor that translocates genomic DNA in empty capsid during DNA packaging. This motor is located at a unique vertex and comprises at least the IVa2 ATPase, the small terminase 33K and probably a portal. Forms a ring-like structure of about 17 nm in which genomic DNA is translocated into the capsid. Stimulates IVa2 ATPase activity in the presence of the viral genome. Once the DNA is packaged, the terminase detaches: the 33K protein is present in the empty particles, but not in the mature virions. Also involved in virion assembly"
        ],
        "length": 217,
        "sequence": "MPPKGNKQAIADRRSQKQQKLQEQWDEEEESWDDSQAEEVSDEEEMESWESLDEELEDKPPKDEEEEIIASAAAPSSKEPARSQPPTGKVGPSPPRPGLLKASRRWDTVSIAGSPPAPVAPTKRSEKTTRPRKEKTSAIATRQDTPVAQELRKRIFPTLYAIFQQSRGQQLELKVKNRSLRSLTRSCLYHRREDQLQRTLEDAEALFNKYCSVSLKD",
        "proteome": null,
        "gene": "L4",
        "go_terms": [
            {
                "identifier": "GO:0019073",
                "name": "viral DNA genome packaging",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "264a97fd5188185d2bc3fd290ddd054e4927822c",
        "counters": {
            "domain_architectures": 497,
            "entries": 2,
            "isoforms": 1,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 497
        }
    }
}