General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P17190",
        "id": "HBEAG_HPBDB",
        "source_organism": {
            "taxId": "10439",
            "scientificName": "Duck hepatitis B virus (isolate brown Shanghai duck S5)",
            "fullName": "Duck hepatitis B virus (isolate brown Shanghai duck S5) (DHBV)"
        },
        "name": "External core antigen",
        "description": [
            "May regulate immune response to the intracellular capsid in acting as a T-cell tolerogen, by having an immunoregulatory effect which prevents destruction of infected cells by cytotoxic T-cells"
        ],
        "length": 305,
        "sequence": "MWNLRITPLSFGAACQGIFTSTLLLSALTVPLVCTIVYDSCLYMDINASRALANVYDLPDDFFPKIDDLVRDAKDALEPYWKSDSIKKHVLIATHFVDLIEDFWQTTQGMHEIAESLRAVIPPTTAPVPTGYLIQHEEAEEIPLGDLFKHQEERIVSFQPDYPITARIHAHLKAYAKINEESLDRARRLLWWHYNCLLWGEANVTNYISRLRTWLSTPEKYRGRDAPTIEAITRPIQVAQGGRKTSSGTRKPRGLEPRRRKVKTTVVYGRRRSKSRDRRAPSPQRAGSPLPRSSSSHHRSPSPRK",
        "proteome": null,
        "gene": "C",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "4d426720b14c2471e9d6b17eae6e43c09ed5c43a",
        "counters": {
            "domain_architectures": 4689,
            "entries": 5,
            "isoforms": 1,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4689
        }
    }
}