GET /api/protein/UniProt/P14157/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P14157",
"id": "HXB5_SHEEP",
"source_organism": {
"taxId": "9940",
"scientificName": "Ovis aries",
"fullName": "Ovis aries (Sheep)"
},
"name": "Homeobox protein Hox-B5",
"description": [
"Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis"
],
"length": 46,
"sequence": "SAPDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHA",
"proteome": "UP000809102",
"gene": "HOXB5",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
"counters": {
"domain_architectures": 145457,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 145457
}
}
}