General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P13636",
        "id": "PEPA_URSTH",
        "source_organism": {
            "taxId": "9642",
            "scientificName": "Ursus thibetanus",
            "fullName": "Ursus thibetanus (Asiatic black bear)"
        },
        "name": "Pepsin A",
        "description": [
            "Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent"
        ],
        "length": 60,
        "sequence": "FIIKVPLVKKKSLRKNLKEHGLLKDFLKKHSPNPASKYFPQEAAVMATQPLENYMDMEYF",
        "proteome": null,
        "gene": "PGA",
        "go_terms": [
            {
                "identifier": "GO:0004190",
                "name": "aspartic-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aec8c03f8a12516c96fe58e1c99cbe3f5e251055",
        "counters": {
            "domain_architectures": 46,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 46
        }
    }
}