GET /api/protein/UniProt/P13636/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P13636",
"id": "PEPA_URSTH",
"source_organism": {
"taxId": "9642",
"scientificName": "Ursus thibetanus",
"fullName": "Ursus thibetanus (Asiatic black bear)"
},
"name": "Pepsin A",
"description": [
"Shows particularly broad specificity; although bonds involving phenylalanine and leucine are preferred, many others are also cleaved to some extent"
],
"length": 60,
"sequence": "FIIKVPLVKKKSLRKNLKEHGLLKDFLKKHSPNPASKYFPQEAAVMATQPLENYMDMEYF",
"proteome": null,
"gene": "PGA",
"go_terms": [
{
"identifier": "GO:0004190",
"name": "aspartic-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "aec8c03f8a12516c96fe58e1c99cbe3f5e251055",
"counters": {
"domain_architectures": 46,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 46
}
}
}