General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P13109",
        "id": "FGF2_RAT",
        "source_organism": {
            "taxId": "10116",
            "scientificName": "Rattus norvegicus",
            "fullName": "Rattus norvegicus (Rat)"
        },
        "name": "Fibroblast growth factor 2",
        "description": [
            "Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Also acts as an integrin ligand which is required for FGF2 signaling (By similarity). Binds to integrin ITGAV:ITGB3 (By similarity). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (By similarity). Functions as a potent mitogen in vitro (By similarity). Can induce angiogenesis (By similarity). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (By similarity)"
        ],
        "length": 154,
        "sequence": "MAAGSITSLPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS",
        "proteome": "UP000002494",
        "gene": "Fgf2",
        "go_terms": [
            {
                "identifier": "GO:0008083",
                "name": "growth factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5171d0377b6deb31d3e4658b327f83b114bedf70",
        "counters": {
            "domain_architectures": 24103,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24103
        }
    }
}