GET /api/protein/UniProt/P13109/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P13109",
"id": "FGF2_RAT",
"source_organism": {
"taxId": "10116",
"scientificName": "Rattus norvegicus",
"fullName": "Rattus norvegicus (Rat)"
},
"name": "Fibroblast growth factor 2",
"description": [
"Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Also acts as an integrin ligand which is required for FGF2 signaling (By similarity). Binds to integrin ITGAV:ITGB3 (By similarity). Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration (By similarity). Functions as a potent mitogen in vitro (By similarity). Can induce angiogenesis (By similarity). Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation (By similarity)"
],
"length": 154,
"sequence": "MAAGSITSLPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS",
"proteome": "UP000002494",
"gene": "Fgf2",
"go_terms": [
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5171d0377b6deb31d3e4658b327f83b114bedf70",
"counters": {
"domain_architectures": 24103,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 24103
}
}
}