General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0DXZ3",
        "id": "DGCR_PSEAS",
        "source_organism": {
            "taxId": "53249",
            "scientificName": "Pseudoalteromonas sp.",
            "fullName": "Pseudoalteromonas sp."
        },
        "name": "HTH-type transcriptional regulator DgcR",
        "description": [
            "Transcriptional regulator that positively regulates the expression of the D-Glu gene cluster (DGC) (PubMed:36690779). The cluster includes dgcN and dgcA, which are involved in a deamination-independent D-glutamate degradation pathway, dgcR itself, dgcT, dgcP and dgcH (PubMed:36690779). Acts by binding the consensus sequence upstream of dgcR, dgcT, dgcP and dgcH (PubMed:36690779)"
        ],
        "length": 291,
        "sequence": "MRLRHIEVFHAIYTTGSITNAAKALHVSQPSVSKVLSHAEMQLGFKLFERVKGRLIPTEEASMLFNEVDKIYQQMRSIKNTAENIKKAEFGNINLSVTPALGFDALPCAIAKYHHAYPKVNFNVQTIHNNEALQALLEHKCDLAVVFSPSAMPGVKAIKIAQSELVAVFPKRLFPSIPAQLTFQELEGAEFIDISDSGPLGHLLWKRMLEENIVLDSTIKVQTYFIAARLVAQGVGVCIVDKYTAMGNLSDDIAIASFSPPLFFNVSALHLENKVLSHVLDAFLNELSNCI",
        "proteome": null,
        "gene": "dgcR",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ceb31193d70a9f57cdd70fc30fe5a3d4d8136d73",
        "counters": {
            "domain_architectures": 612484,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 612484
        }
    }
}