GET /api/protein/UniProt/P0DUS2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0DUS2",
"id": "Z11_DORVU",
"source_organism": {
"taxId": "1372962",
"scientificName": "Doratifera vulnerans",
"fullName": "Doratifera vulnerans (Mottled cup moth)"
},
"name": "Z-limacoditoxin(1)-Dv1",
"description": [
"Potently activates insect G protein-coupled receptor. It activates the ACP receptor (ACPR) from the mosquito A.aegypti (EC(50)=0.55 nM) with a potency comparable to that of the endogenous ligand. Has no activity on receptors of the closely related neuropeptides adipokinetic hormone and corazonin. In vivo, does not reveal any observable effects when injected into crickets (A.domesticus). Does not induce increase in intracellular calcium in mouse DRG neurons, suggesting that it does not induce pain"
],
"length": 35,
"sequence": "MKKTFLPIFLVILLASYALANPQVTFSRDWGPGKK",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"prosite": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1
}
}
}