HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0DH60",
"id": "M3OM2_PEA",
"source_organism": {
"taxId": "3888",
"scientificName": "Pisum sativum",
"fullName": "Pisum sativum (Garden pea)"
},
"name": "(+)-6a-hydroxymaackiain 3-O-methyltransferase 2",
"description": [
"3-O-methyltransferase involved in the phytoalexin pisatin biosynthesis. Can use (+)-6a-hydroxymaackiain, (+)-maackiain and with a lower activity (+)-medicarpin and 2,7,4'-trihydroxyisoflavanone as substrates, but not (-)-6a-hydroxymaackiain, daidzein, formononetin or isoliquiritigenin"
],
"length": 360,
"sequence": "MDFSTNGSEESELYHAQIHLYKHIYNFVSSMALKSAVELGIADAIHNHGKPMTLPELASSLKLHPSKVNILYRFLRLLTHNGFFAKTTVKSNGEEEETAYVLTPSSKLLVSGKSTCLSSVVKGALHPISLDLWGVSKKWFHEDKEQTLFECATGENYWDFLNKDSDYLSIFQDAMAADSRLFKLAIQENKHVFEGLESLVDVAGGTGGVAKLIHEAFPHIKCTVFDQPQVVGNLTGNENLNFVSGDMFKSVPSADAVLLKWVLHDWNDELSLKILKKSKEAISHKGKDGKVIIIDISIDDNSDDHGLTELQLEYDVVMLTMFLGKERTKKEWEKLIYDAGFSRYKITPICGFKSLIEVYP",
"proteome": null,
"gene": "HMM2",
"go_terms": [
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008171",
"name": "O-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bdc835ccb83003619dd55371e507d9b3256eafa8",
"counters": {
"domain_architectures": 30676,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30676
}
}
}