GET /api/protein/UniProt/P0DH60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0DH60",
        "id": "M3OM2_PEA",
        "source_organism": {
            "taxId": "3888",
            "scientificName": "Pisum sativum",
            "fullName": "Pisum sativum (Garden pea)"
        },
        "name": "(+)-6a-hydroxymaackiain 3-O-methyltransferase 2",
        "description": [
            "3-O-methyltransferase involved in the phytoalexin pisatin biosynthesis. Can use (+)-6a-hydroxymaackiain, (+)-maackiain and with a lower activity (+)-medicarpin and 2,7,4'-trihydroxyisoflavanone as substrates, but not (-)-6a-hydroxymaackiain, daidzein, formononetin or isoliquiritigenin"
        ],
        "length": 360,
        "sequence": "MDFSTNGSEESELYHAQIHLYKHIYNFVSSMALKSAVELGIADAIHNHGKPMTLPELASSLKLHPSKVNILYRFLRLLTHNGFFAKTTVKSNGEEEETAYVLTPSSKLLVSGKSTCLSSVVKGALHPISLDLWGVSKKWFHEDKEQTLFECATGENYWDFLNKDSDYLSIFQDAMAADSRLFKLAIQENKHVFEGLESLVDVAGGTGGVAKLIHEAFPHIKCTVFDQPQVVGNLTGNENLNFVSGDMFKSVPSADAVLLKWVLHDWNDELSLKILKKSKEAISHKGKDGKVIIIDISIDDNSDDHGLTELQLEYDVVMLTMFLGKERTKKEWEKLIYDAGFSRYKITPICGFKSLIEVYP",
        "proteome": null,
        "gene": "HMM2",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008171",
                "name": "O-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bdc835ccb83003619dd55371e507d9b3256eafa8",
        "counters": {
            "domain_architectures": 30676,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 1,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30676
        }
    }
}