General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0CH12",
        "id": "KA125_LYCMC",
        "source_organism": {
            "taxId": "172552",
            "scientificName": "Lychas mucronatus",
            "fullName": "Lychas mucronatus (Chinese swimming scorpion)"
        },
        "name": "Potassium channel toxin alpha-KTx 12.5",
        "description": [
            "This recombinant toxin inhibits the mammalian voltage-gated potassium channels Kv1.3/KCNA3 (IC(50)=28 nM). Kv1.1/KCNA1 and Kv1.2/KCNA2 potassium channels are also weakly inhibited (IC(50)=1.73 uM and IC(50)=12.63 uM, respectively)"
        ],
        "length": 60,
        "sequence": "MNKLPILIFMLLVCSMFISSDCQKHTDIKCSSSSSCYEPCRGVTGRAHGKCMNGRCTCYY",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0008200",
                "name": "ion channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "edc53731ca9e1538837bf0c0212e1bbba7568ac8",
        "counters": {
            "domain_architectures": 254,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 254
        }
    }
}