General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0CAR9",
        "id": "PA2A1_CERCE",
        "source_organism": {
            "taxId": "8697",
            "scientificName": "Cerastes cerastes",
            "fullName": "Cerastes cerastes (Horned desert viper)"
        },
        "name": "Acidic phospholipase A2 CC-PLA2-1",
        "description": [
            "Snake venom phospholipase A2 (PLA2) that inhibits blood coagulation and platelet aggregation induced by ADP and arachidonic acid. Inhibits tumor cell adhesion and migration in a dose-dependent manner. Abolishes the attachment of human brain microvascular endothelial cells (HBMEC) to fibrinogen (IC(50)=0.12 uM) and dramatically reduces its adhesion to fibronectin (IC(50)=0.12 uM), whereas no effect is observed on type I collagen, vitronectin or laminin 1. Also blocks the cell migration toward fibronectin and fibrinogen. These effects are not dependent of the catalytic activity, but are mediated by alpha-5/beta-1 (ITGA5/ITGB1) and alpha-v-containing (ITGAV) integrins. Also shows anti-angiogenic activity in chicken chorioallantoix membrane assay. Has a relatively high enzymatic activity. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides"
        ],
        "length": 137,
        "sequence": "MRTLWIVAVWLMGVEGNLYQFGKMIKHKTGKSALLSYSAYGCYCGWGGQGKPQDATDHCCFVHDCCYGEVSGCYPKTAFTLKFENQDIICGDEDPCNRAVCECDRVAAICFGENVNTSDKKYLFYSSSYCEEESEQC",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004623",
                "name": "A2-type glycerophospholipase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006644",
                "name": "phospholipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050482",
                "name": "arachidonate secretion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016042",
                "name": "lipid catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bd0c304bac6c9e2ec8f8d5ae78d4c8944ec3a50b",
        "counters": {
            "domain_architectures": 9115,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "smart": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9115
        }
    }
}