GET /api/protein/UniProt/P0A8Y9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0A8Y9",
"id": "ENTH_ECOL6",
"source_organism": {
"taxId": "199310",
"scientificName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)",
"fullName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)"
},
"name": "Proofreading thioesterase EntH",
"description": [
"Required for optimal enterobactin synthesis. Acts as a proofreading enzyme that prevents EntB misacylation by hydrolyzing the thioester bound existing between EntB and wrongly charged molecules"
],
"length": 137,
"sequence": "MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQPLHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG",
"proteome": "UP000001410",
"gene": "entH",
"go_terms": [
{
"identifier": "GO:0016790",
"name": "thiolester hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009239",
"name": "enterobactin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83515c55570f61cfb5e878ab31f7d2777385a86e",
"counters": {
"domain_architectures": 114854,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"ncbifam": 2,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 114854
}
}
}