HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P0A7I5",
"id": "RF3_ECOL6",
"source_organism": {
"taxId": "199310",
"scientificName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)",
"fullName": "Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)"
},
"name": "Peptide chain release factor 3",
"description": [
"Increases the formation of ribosomal termination complexes and stimulates activities of RF-1 and RF-2. It binds guanine nucleotides and has strong preference for UGA stop codons. It may interact directly with the ribosome. The stimulation of RF-1 and RF-2 is significantly reduced by GTP and GDP, but not by GMP (By similarity)"
],
"length": 529,
"sequence": "MTLSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMAGDRSHVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPLKQKQLLKGLVQLSEEGAVQVFRPISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADAKKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH",
"proteome": "UP000001410",
"gene": "prfC",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006415",
"name": "translational termination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2ef9095a6601d7d8c5b2d55ce7e18dd9b8cacb0f",
"counters": {
"domain_architectures": 17934,
"entries": 30,
"isoforms": 0,
"proteomes": 1,
"sets": 6,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 3,
"profile": 1,
"cdd": 3,
"pfam": 3,
"ncbifam": 3,
"cathgene3d": 2,
"hamap": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 11
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17934
}
}
}