GET /api/protein/UniProt/P08983/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P08983",
        "id": "CXB1_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Gap junction beta-1 protein",
        "description": [
            "One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell"
        ],
        "length": 264,
        "sequence": "MNWAGLYAILSGVNRHSTSIGRIWLSVVFIFRIMVLVAAAESVWGDEKSAFTCNTQQPGCNSVCYDHFFPISHIRLWALQLIIVSTPALLVAMHVAHLQHQEKKELRLSRHVKDQELAEVKKHKVKISGTLWWTYISSVFFRIIFEAAFMYIFYLIYPGYSMIRLLKCDAYPCPNTVDCFVSRPTEKTIFTVFMLVASGVCIVLNVAEVFFLIAQACTRRARRHRDSGSISKEHQQNEMNLLITGGSIIKRSAGQEKGDHCSTS",
        "proteome": "UP000186698",
        "gene": "gjb1",
        "go_terms": [
            {
                "identifier": "GO:0007154",
                "name": "cell communication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005922",
                "name": "connexin complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8a825e27a9aba93bc304f1472053b3edc06a046c",
        "counters": {
            "domain_architectures": 16666,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 2,
                "panther": 1,
                "prints": 2,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16666
        }
    }
}