GET /api/protein/UniProt/P00676/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P00676",
"id": "RNAS1_MYOCO",
"source_organism": {
"taxId": "10157",
"scientificName": "Myocastor coypus",
"fullName": "Myocastor coypus (Coypu)"
},
"name": "Ribonuclease pancreatic",
"description": [
"Endonuclease that catalyzes the cleavage of RNA on the 3' side of pyrimidine nucleotides. Acts on single-stranded and double-stranded RNA (By similarity)"
],
"length": 128,
"sequence": "SESSAKKFERQHMDSRGSPSTNPNYCNEMMKSRNMTQGRCKPVNTFVHEPLADVQAVCFQKNVLCKNGQTNCYQSNSNMHITDCRVTSNSDYPNCSYRTSQEEKSIVVACEGNPYVPVHFDASVAASA",
"proteome": null,
"gene": "RNASE1",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "98d68b12bd3f8712f6c8af8279bf34350ea81404",
"counters": {
"domain_architectures": 4309,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4309
}
}
}