GET /api/protein/UniProt/O80630/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O80630",
        "id": "DIR9_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "Dirigent protein 9",
        "description": [
            "Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism"
        ],
        "length": 322,
        "sequence": "MAKALHITIFLFLISSNLLAFINSARLLDEIQPQPQLVPTGQIPTVAPTEAEEEDGTDDNPGLATTTTTASAVTVPAGPAEATEPLLEFFMHDVLGGSHPSARVVTGIVAQTEVNGIPFSKASNSIFPVDNGVPLVNSNNINSVINPNTAPLLTGLGGAQTSTVIQNTNGNSNDALSANSLPFVTAGNLPPGAALQHLMFGTITVVDDELTESHELGSAVIGRAQGFYLASSLDGTSQTLSLTVLLHGEHDQHDTLDDAISFFGVHRTASHASQIAVIGGTGKFEHAKGYAIVETLHNQDNQHITDGQDTILHFSVYLTYKA",
        "proteome": "UP000006548",
        "gene": "DIR9",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3d4a9bb835893a45d07f9261782f557ffe98e74b",
        "counters": {
            "domain_architectures": 16083,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 16083
        }
    }
}