HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "O77728",
"id": "CEBPE_SHEEP",
"source_organism": {
"taxId": "9940",
"scientificName": "Ovis aries",
"fullName": "Ovis aries (Sheep)"
},
"name": "CCAAT/enhancer-binding protein epsilon",
"description": [
"Transcriptional activator. C/EBP are DNA-binding proteins that recognize two different motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Required for the promyelocyte-myelocyte transition in myeloid differentiation"
],
"length": 281,
"sequence": "MSHGTYYECEPRAGQQPLEFSGARAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARELKGPGTPAFPHYLPADPRPFTYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRGASRSGYNPLQYQVAHCGQTAMHLPPGLASPSQPLRVLKAPLAAAAPPCSPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS",
"proteome": "UP000809102",
"gene": "CEBPE",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a717fccfe9f8231ef9b8e8f55ac365baa9863a41",
"counters": {
"domain_architectures": 26457,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"smart": 1,
"profile": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26457
}
}
}