General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O75002",
        "id": "MOG1_SCHPO",
        "source_organism": {
            "taxId": "284812",
            "scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)",
            "fullName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)"
        },
        "name": "Nuclear import protein mog1",
        "description": [
            "Involved in the Ran-GTPase system for nuclear protein import and poly(A)+ mRNA export. Required for mitosis-to-interphase transition"
        ],
        "length": 190,
        "sequence": "MVQLFGGALCADFPPKFLDASVLRQIPDNQEVFLQDSKENLTVIIELLEKIEKPFDGSVAAYHFNSIAFDNDASQRVIWRDKSLGEDDFEGMRSEKASGSSVQGCQRVLEKGKRNPESATNVAIFVNVITLIDFQTDIVISVNAPLPNTSSVPSSVENIPPSDQSIVRAALETIQRVTRSLVLVDKTVFA",
        "proteome": "UP000002485",
        "gene": "mog1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0283c1bcbc7e58d3a48f65131ec33b809fa9a068",
        "counters": {
            "domain_architectures": 3390,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3390
        }
    }
}