General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "O67045",
        "id": "ISCU_AQUAE",
        "source_organism": {
            "taxId": "224324",
            "scientificName": "Aquifex aeolicus (strain VF5)",
            "fullName": "Aquifex aeolicus (strain VF5)"
        },
        "name": "Iron-sulfur cluster assembly scaffold protein IscU",
        "description": [
            "A scaffold on which IscS assembles Fe-S clusters. Subsequently gives the nascent cluster to other proteins. It is likely that Fe-S cluster coordination is flexible as the role of this complex is to build and then hand off Fe-S clusters (Probable)"
        ],
        "length": 157,
        "sequence": "MSFEYNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGDAMLFTIKVNPENDVIEDVRFKTFGCGSAIAVSSMLTEMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQGRVEEASKIPDCYEEEEEQEESKEFEFLSGT",
        "proteome": "UP000000798",
        "gene": "iscU",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1a14465eba7d2532ef70113b6acb6327d7aa9427",
        "counters": {
            "domain_architectures": 26938,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 1,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26938
        }
    }
}